(data stored in SCRATCH zone)

EMBL: CP000423.PE163

CP000423.PE163       Location/Qualifiers
FT   CDS             163472..164818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0165"
FT                   /product="Recombination protein MgsA"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69029"
FT                   /db_xref="GOA:Q03CP3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032423"
FT                   /db_xref="UniProtKB/TrEMBL:Q03CP3"
FT                   /protein_id="ABJ69029.1"
FT                   /translation="MDQSLFQNGNFQPLASRMRPQTLDEFVGQTHLLGKDKVLSNLIEH
FT                   DEISSMIFWGPPGVGKTTLARIIARRTKAQFVTFSAVTSGIKEIKQVMKEAEQNRELGQ
FT                   KTIVFVDEIHRFNKAQQDAFLPYVERGSIILIGATTENPSFEVNAALLSRTRVFVLHGL
FT                   TSAELVDLLQRALKDPRGYGLQKVKIGKKLLAQIADFANGDARIALNTLEMAVTNAETK
FT                   GGVITVTQADVAQLLTKKALLYDKNGEEHYNLISALHKSMRNSDVDAAIYWLARMLEAG
FT                   EDPLYVARRLVRFASEDIGMADSRALEITIAVYQACQFIGMPECTVHLTHAVTYLALAP
FT                   KSNALYTAYEGAKKDATETLAEPVPLQIRNGVTDLMQDLGYGKDYQYAHNTKDKLTTMQ
FT                   TMPDNLIGKTYYHPTTQGSEAKVKERLEQIKAWHAQHPDPDSPKTKKKS"
     MDQSLFQNGN FQPLASRMRP QTLDEFVGQT HLLGKDKVLS NLIEHDEISS MIFWGPPGVG        60
     KTTLARIIAR RTKAQFVTFS AVTSGIKEIK QVMKEAEQNR ELGQKTIVFV DEIHRFNKAQ       120
     QDAFLPYVER GSIILIGATT ENPSFEVNAA LLSRTRVFVL HGLTSAELVD LLQRALKDPR       180
     GYGLQKVKIG KKLLAQIADF ANGDARIALN TLEMAVTNAE TKGGVITVTQ ADVAQLLTKK       240
     ALLYDKNGEE HYNLISALHK SMRNSDVDAA IYWLARMLEA GEDPLYVARR LVRFASEDIG       300
     MADSRALEIT IAVYQACQFI GMPECTVHLT HAVTYLALAP KSNALYTAYE GAKKDATETL       360
     AEPVPLQIRN GVTDLMQDLG YGKDYQYAHN TKDKLTTMQT MPDNLIGKTY YHPTTQGSEA       420
     KVKERLEQIK AWHAQHPDPD SPKTKKKS                                          448
//

If you have problems or comments...

PBIL Back to PBIL home page