(data stored in SCRATCH zone)

EMBL: CP000423.PE164

CP000423.PE164       Location/Qualifiers
FT   CDS             164876..166066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0166"
FT                   /product="acetate kinase"
FT                   /EC_number="2.7.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69030"
FT                   /db_xref="GOA:Q03CP2"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03CP2"
FT                   /protein_id="ABJ69030.1"
FT                   /translation="MAKILAVNAGSSTLKWKLFDMPAEVQLAEGLVDRLGQPQSKVKIK
FT                   YGDGQKYESDTPIANYQEAVASLMGNIKALGLVEHLHEITGVGHRVVAGGETFAESVVV
FT                   DDATLLQIQNLRDYAPLHNPVEADYIDVFKKMMPWATEVAVFDTAFHQTMQPENFLYSI
FT                   PYDYYKKYGARKYGAHGTSVRYVSARAAEMLNKPLEDLRMIVMHLGSGSSVTAVQGGQS
FT                   IDTSMGFTPLAGVTMGTRSGDIDPSLVAYLMKKLDVPDVGQMIHILNNDSGLLGISGIS
FT                   NDMRDLEADEDTKPRAKLALDIFVNRVVKYVGSYAALMDGVDVLVFTAGIGENGDEIRD
FT                   KIMRSLDYLGAKIDNDINYKSHGVEADLSTPDSTVKTLLVPTNEELMIVRDVMALS"
     MAKILAVNAG SSTLKWKLFD MPAEVQLAEG LVDRLGQPQS KVKIKYGDGQ KYESDTPIAN        60
     YQEAVASLMG NIKALGLVEH LHEITGVGHR VVAGGETFAE SVVVDDATLL QIQNLRDYAP       120
     LHNPVEADYI DVFKKMMPWA TEVAVFDTAF HQTMQPENFL YSIPYDYYKK YGARKYGAHG       180
     TSVRYVSARA AEMLNKPLED LRMIVMHLGS GSSVTAVQGG QSIDTSMGFT PLAGVTMGTR       240
     SGDIDPSLVA YLMKKLDVPD VGQMIHILNN DSGLLGISGI SNDMRDLEAD EDTKPRAKLA       300
     LDIFVNRVVK YVGSYAALMD GVDVLVFTAG IGENGDEIRD KIMRSLDYLG AKIDNDINYK       360
     SHGVEADLST PDSTVKTLLV PTNEELMIVR DVMALS                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page