(data stored in SCRATCH zone)

EMBL: CP000423.PE17

CP000423.PE17        Location/Qualifiers
FT   CDS             complement(16694..17287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0017"
FT                   /product="Predicted integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ68883"
FT                   /db_xref="GOA:Q03D39"
FT                   /db_xref="InterPro:IPR010617"
FT                   /db_xref="UniProtKB/TrEMBL:Q03D39"
FT                   /protein_id="ABJ68883.1"
FT                   /translation="MNKGRVEAFTDAVVAIILTIMVLEFKTPETAKWTGIIHQLPYFFA
FT                   YIVSFLFVGVAWYNHHYMFALALRISKKVYWINNLWLFSMSLLPVATGWVGKFPQATGP
FT                   EYLYLFVFIFWSLSYLWLSDAIRKTPEHVHTAVSQKIAQMFPFKFLSSIFFPLSVVITA
FT                   ISIYFYPALGISITFVGLIILSFLTPSDSDQVSQ"
     MNKGRVEAFT DAVVAIILTI MVLEFKTPET AKWTGIIHQL PYFFAYIVSF LFVGVAWYNH        60
     HYMFALALRI SKKVYWINNL WLFSMSLLPV ATGWVGKFPQ ATGPEYLYLF VFIFWSLSYL       120
     WLSDAIRKTP EHVHTAVSQK IAQMFPFKFL SSIFFPLSVV ITAISIYFYP ALGISITFVG       180
     LIILSFLTPS DSDQVSQ                                                      197
//

If you have problems or comments...

PBIL Back to PBIL home page