(data stored in SCRATCH zone)

EMBL: CP000423.PE175

CP000423.PE175       Location/Qualifiers
FT   CDS             180312..181610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0178"
FT                   /product="Phosphotransferase system,
FT                   mannose/fructose/N-acetylgalactosamine-specific component
FT                   IID, with ABC-type ATPase domain"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69041"
FT                   /db_xref="GOA:Q03CN1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q03CN1"
FT                   /protein_id="ABJ69041.1"
FT                   /translation="MYFEDRTNGLLRQVHDSVMMIFIGASPERFASSQLLWLLLWFGYM
FT                   LLPIFASAGITHTYQQGLYPYLNLRFRPRVLTYLWPLKQTWMIEAGVLLFMGVGFGLAS
FT                   FLFWQEQQLFTAGLFTGLIVMSQLLLLVMETVLEGYFGIVIGVVGPLVMIFLSFLQMPL
FT                   MPLRFAIGSTFASDQQLLGAIGYQLGLIIGLVLIQIFYMPGRWGVMPQIIHEPAVHLEV
FT                   EQLSVTIKRKKILDHLSLSLVSPNIYGIVGPNGTGKSVLLKTLLGFIRPSAGSVKMNGV
FT                   RVDPRHDLPVSVGAIIEHPGFIGDLNGHDNLMALGNIRSQLSDADIRAIMEKVGLSDDR
FT                   KAVADYSLGMIQRLGIAQAIMEDQQLILLDEPTNALDREGVAFLTDLLRELRDQGKLVV
FT                   VASHDFMWLQLLADQIFELTGGQLNKLEAGQPL"
     MYFEDRTNGL LRQVHDSVMM IFIGASPERF ASSQLLWLLL WFGYMLLPIF ASAGITHTYQ        60
     QGLYPYLNLR FRPRVLTYLW PLKQTWMIEA GVLLFMGVGF GLASFLFWQE QQLFTAGLFT       120
     GLIVMSQLLL LVMETVLEGY FGIVIGVVGP LVMIFLSFLQ MPLMPLRFAI GSTFASDQQL       180
     LGAIGYQLGL IIGLVLIQIF YMPGRWGVMP QIIHEPAVHL EVEQLSVTIK RKKILDHLSL       240
     SLVSPNIYGI VGPNGTGKSV LLKTLLGFIR PSAGSVKMNG VRVDPRHDLP VSVGAIIEHP       300
     GFIGDLNGHD NLMALGNIRS QLSDADIRAI MEKVGLSDDR KAVADYSLGM IQRLGIAQAI       360
     MEDQQLILLD EPTNALDREG VAFLTDLLRE LRDQGKLVVV ASHDFMWLQL LADQIFELTG       420
     GQLNKLEAGQ PL                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page