(data stored in SCRATCH zone)

EMBL: CP000423.PE176

CP000423.PE176       Location/Qualifiers
FT   CDS             181607..182083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0179"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69042"
FT                   /db_xref="UniProtKB/TrEMBL:Q03CN0"
FT                   /protein_id="ABJ69042.1"
FT                   /translation="MKKLHRRLLAVGLLAMIMIFVALFSWRYQTLNAPLAHPAVKTRSL
FT                   SLPAKVVLHRRTVSLEKVEATIVHGQWRVRLHFRQPITKQNMKHMKFQLAQQREGREVP
FT                   NEPQADLSQDQKVITMMDAYYSRATDNRVVITTLPQALNSQNLVQIVPFESSRK"
     MKKLHRRLLA VGLLAMIMIF VALFSWRYQT LNAPLAHPAV KTRSLSLPAK VVLHRRTVSL        60
     EKVEATIVHG QWRVRLHFRQ PITKQNMKHM KFQLAQQREG REVPNEPQAD LSQDQKVITM       120
     MDAYYSRATD NRVVITTLPQ ALNSQNLVQI VPFESSRK                               158
//

If you have problems or comments...

PBIL Back to PBIL home page