(data stored in SCRATCH zone)

EMBL: CP000423.PE188

CP000423.PE188       Location/Qualifiers
FT   CDS             complement(194086..194292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0191"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69054"
FT                   /db_xref="UniProtKB/TrEMBL:Q03CL8"
FT                   /protein_id="ABJ69054.1"
FT                   /translation="MAEKDQISAFSREIIDFQRKNHLTDTEMALNSHVSVEHIHNIKSM
FT                   REMPDSSVVATLKDYMEHKPSGK"
     MAEKDQISAF SREIIDFQRK NHLTDTEMAL NSHVSVEHIH NIKSMREMPD SSVVATLKDY        60
     MEHKPSGK                                                                 68
//

If you have problems or comments...

PBIL Back to PBIL home page