(data stored in SCRATCH zone)

EMBL: CP000423.PE245

CP000423.PE245       Location/Qualifiers
FT   CDS             complement(248360..249739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0248"
FT                   /product="Branched-chain amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69111"
FT                   /db_xref="GOA:Q03CG1"
FT                   /db_xref="InterPro:IPR004685"
FT                   /db_xref="UniProtKB/TrEMBL:Q03CG1"
FT                   /protein_id="ABJ69111.1"
FT                   /translation="MSPQPTLTKRQYLTLGSLLFGMFFGAGNLIFPIHMGQLAGSAWLP
FT                   AAIGFLLSAVLLPLLSIMAISLTRASSMYDLARPAGHSFALFFLLATHASLGLLIASPR
FT                   TATVTYSIGIAPFLGKGQQQIGLLIFSFIFFLTTFLLARNESKITTYIGKLLNPLLLIL
FT                   LAVIFFWALVIKGDIRAISFTSSPKLMSSNLINGFLQGYNTMDALAGLGFGVTIITALK
FT                   LMGLHQASTRAKAVAKVGSLAMGLEALIYMLLILLGAISLGFSKLTANGGTAFNQIMTH
FT                   YTGLIGTALLGAMTLLACLTTAIGLVTSFSQDLGHRFPKLGYHFFLPMTTIGAFLIANF
FT                   GLDQIIAYSTPILMLLYPLAIALIMLGLMHPWIGKNTRIYKTTVAFTMIPALLDAIHAL
FT                   PAGLAQLPIFSSIQQFATTYIPWFGIGMDFVPFLLIGFLTGFIAAKLSGHKLAPDLPDP
FT                   D"
     MSPQPTLTKR QYLTLGSLLF GMFFGAGNLI FPIHMGQLAG SAWLPAAIGF LLSAVLLPLL        60
     SIMAISLTRA SSMYDLARPA GHSFALFFLL ATHASLGLLI ASPRTATVTY SIGIAPFLGK       120
     GQQQIGLLIF SFIFFLTTFL LARNESKITT YIGKLLNPLL LILLAVIFFW ALVIKGDIRA       180
     ISFTSSPKLM SSNLINGFLQ GYNTMDALAG LGFGVTIITA LKLMGLHQAS TRAKAVAKVG       240
     SLAMGLEALI YMLLILLGAI SLGFSKLTAN GGTAFNQIMT HYTGLIGTAL LGAMTLLACL       300
     TTAIGLVTSF SQDLGHRFPK LGYHFFLPMT TIGAFLIANF GLDQIIAYST PILMLLYPLA       360
     IALIMLGLMH PWIGKNTRIY KTTVAFTMIP ALLDAIHALP AGLAQLPIFS SIQQFATTYI       420
     PWFGIGMDFV PFLLIGFLTG FIAAKLSGHK LAPDLPDPD                              459
//

If you have problems or comments...

PBIL Back to PBIL home page