(data stored in SCRATCH zone)

EMBL: CP000423.PE295

CP000423.PE295       Location/Qualifiers
FT   CDS             302791..303618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0301"
FT                   /product="Hydroxymethylpyrimidine/phosphomethylpyrimidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69161"
FT                   /db_xref="GOA:Q03CB1"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q03CB1"
FT                   /protein_id="ABJ69161.1"
FT                   /translation="MTVNRTPQVVTIAGSDSGGGAGLQADLKTFQARHVFGMSIVVALT
FT                   AQNTYGVQASLPIPAGFIDAQFQSLAADFDIRAAKTGMLADREHVEAVVRNLQQVDFGP
FT                   LIVDPVMVAKGGATLLASEAVVTIKEQLLPLADVVTPNLPEAEILVGKKIVTNADMVQA
FT                   ARTIQTLGVKHVIIKGGHRQNHKAEDLILLADGTCYWLSAPRIATANTHGTGDTFSACI
FT                   AAELAKGQPLKAAIMTAKAFLQGAISQGISVGHGHGPTNHWAKLSEKVSLRQG"
     MTVNRTPQVV TIAGSDSGGG AGLQADLKTF QARHVFGMSI VVALTAQNTY GVQASLPIPA        60
     GFIDAQFQSL AADFDIRAAK TGMLADREHV EAVVRNLQQV DFGPLIVDPV MVAKGGATLL       120
     ASEAVVTIKE QLLPLADVVT PNLPEAEILV GKKIVTNADM VQAARTIQTL GVKHVIIKGG       180
     HRQNHKAEDL ILLADGTCYW LSAPRIATAN THGTGDTFSA CIAAELAKGQ PLKAAIMTAK       240
     AFLQGAISQG ISVGHGHGPT NHWAKLSEKV SLRQG                                  275
//

If you have problems or comments...

PBIL Back to PBIL home page