(data stored in SCRATCH zone)

EMBL: CP000423.PE3

CP000423.PE3         Location/Qualifiers
FT   CDS             3320..3532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0003"
FT                   /product="S4-like RNA binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ68869"
FT                   /db_xref="GOA:Q03D53"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014330"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q03D53"
FT                   /protein_id="ABJ68869.1"
FT                   /translation="MTTIEITTPFLTLGQFLKEAGLIDSGGAAKWYLGENSVTVNGAAE
FT                   ERRGRKLYPDDQVSVAGQTYVIVSA"
     MTTIEITTPF LTLGQFLKEA GLIDSGGAAK WYLGENSVTV NGAAEERRGR KLYPDDQVSV        60
     AGQTYVIVSA                                                               70
//

If you have problems or comments...

PBIL Back to PBIL home page