(data stored in SCRATCH zone)

EMBL: CP000423.PE303

CP000423.PE303       Location/Qualifiers
FT   CDS             309502..310482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0309"
FT                   /product="ribose ABC transporter membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69169"
FT                   /db_xref="GOA:Q03CA3"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q03CA3"
FT                   /protein_id="ABJ69169.1"
FT                   /translation="MQEQSKAKTSSKIDVKKIFSRLGPLLALVVLVILVTIMSPTFVSP
FT                   ANLLNLLRQVSINAVIAFGMTFVILTGGIDLSVGSILALSGAVTASMLASGFAAPLALL
FT                   AGLVLGAIFGLLNGILIAYGKAAPFIATLATMTIFRGATYVFTNGNPITGAKMNSSFLF
FT                   QFMGRGYLFGIPFPIIIMLVAYGVLFVLLHKTSFGRKTYALGGNETAARIAGVRTKMVT
FT                   MLIYTISGLMAAIAGIILTSRLSSAQPDAGTSYEMDAIAAVVLGGTSLAGGKGRIFGTL
FT                   IGALIIGTLNNGMNLLGISSFYQQIVKGIVILIAVLLDRRSSNNG"
     MQEQSKAKTS SKIDVKKIFS RLGPLLALVV LVILVTIMSP TFVSPANLLN LLRQVSINAV        60
     IAFGMTFVIL TGGIDLSVGS ILALSGAVTA SMLASGFAAP LALLAGLVLG AIFGLLNGIL       120
     IAYGKAAPFI ATLATMTIFR GATYVFTNGN PITGAKMNSS FLFQFMGRGY LFGIPFPIII       180
     MLVAYGVLFV LLHKTSFGRK TYALGGNETA ARIAGVRTKM VTMLIYTISG LMAAIAGIIL       240
     TSRLSSAQPD AGTSYEMDAI AAVVLGGTSL AGGKGRIFGT LIGALIIGTL NNGMNLLGIS       300
     SFYQQIVKGI VILIAVLLDR RSSNNG                                            326
//

If you have problems or comments...

PBIL Back to PBIL home page