(data stored in SCRATCH zone)

EMBL: CP000423.PE315

CP000423.PE315       Location/Qualifiers
FT   CDS             321642..322100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0321"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69181"
FT                   /db_xref="GOA:Q03C91"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:Q03C91"
FT                   /protein_id="ABJ69181.1"
FT                   /translation="MKNMLAVIVLGPFIEWKIGSTPFVISFFVSSWLGVLLFCFGFGGF
FT                   IQSAFGIGTYIESFYGVSLSGYALFPLAILAFLIEKPTFSFMTKIVAFTSTLYYVTVGY
FT                   WPNLAMSDIEKNVQVAHSCGLLVGLFCVLVILIIKHREKMFSFSSRSK"
     MKNMLAVIVL GPFIEWKIGS TPFVISFFVS SWLGVLLFCF GFGGFIQSAF GIGTYIESFY        60
     GVSLSGYALF PLAILAFLIE KPTFSFMTKI VAFTSTLYYV TVGYWPNLAM SDIEKNVQVA       120
     HSCGLLVGLF CVLVILIIKH REKMFSFSSR SK                                     152
//

If you have problems or comments...

PBIL Back to PBIL home page