(data stored in SCRATCH zone)

EMBL: CP000423.PE325

CP000423.PE325       Location/Qualifiers
FT   CDS             331556..332425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0331"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69191"
FT                   /db_xref="GOA:Q03C81"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q03C81"
FT                   /protein_id="ABJ69191.1"
FT                   /translation="MIKILLGLIVLINLGFVFYFIRDLLRHRSDVMSEPATTWALPFSS
FT                   FIIFLLSTFGISDFAISTALYPKAKWVSIKKLPGTLNTQCVVPVAAMALSYITAITVDI
FT                   KTLAVCIIAAVIGAYIGPRFVVKLPANTIKKFVTAGLIIAALMILAGKFNWIPANGTAT
FT                   SLSGWKLMLTAILLFIYGALNNIGIGSYALTMATVYAMGLNPSAAFPIMMGAATFSVST
FT                   SSIQFVKLADYSRKITLFTSTFGVLGVLVAVFFVKSLDTSMLQWLVIIVLLYSAISMAL
FT                   SLRQKGEA"
     MIKILLGLIV LINLGFVFYF IRDLLRHRSD VMSEPATTWA LPFSSFIIFL LSTFGISDFA        60
     ISTALYPKAK WVSIKKLPGT LNTQCVVPVA AMALSYITAI TVDIKTLAVC IIAAVIGAYI       120
     GPRFVVKLPA NTIKKFVTAG LIIAALMILA GKFNWIPANG TATSLSGWKL MLTAILLFIY       180
     GALNNIGIGS YALTMATVYA MGLNPSAAFP IMMGAATFSV STSSIQFVKL ADYSRKITLF       240
     TSTFGVLGVL VAVFFVKSLD TSMLQWLVII VLLYSAISMA LSLRQKGEA                   289
//

If you have problems or comments...

PBIL Back to PBIL home page