(data stored in SCRATCH zone)

EMBL: CP000423.PE337

CP000423.PE337       Location/Qualifiers
FT   CDS             344092..344661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0344"
FT                   /product="Site-specific recombinase, DNA invertase Pin
FT                   related protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69203"
FT                   /db_xref="GOA:Q03C69"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:Q03C69"
FT                   /protein_id="ABJ69203.1"
FT                   /translation="MKYGYARVSTTDQKLANQIELLKLAGAEKVFQEKFTGTTTARPEF
FT                   QKLLQALKTDDTLIVTKLDRFARNTREALTIIQELFNRNIKVNILNMGLIDNTPTGQLV
FT                   FTIFSAFAQFERDMIVTRTQEGKLYAKQHDPLFREGRPKTYSDEQIRFAYELRKQGMTY
FT                   KMIERKTGISKRTQQRRFKLVKNNIF"
     MKYGYARVST TDQKLANQIE LLKLAGAEKV FQEKFTGTTT ARPEFQKLLQ ALKTDDTLIV        60
     TKLDRFARNT REALTIIQEL FNRNIKVNIL NMGLIDNTPT GQLVFTIFSA FAQFERDMIV       120
     TRTQEGKLYA KQHDPLFREG RPKTYSDEQI RFAYELRKQG MTYKMIERKT GISKRTQQRR       180
     FKLVKNNIF                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page