(data stored in SCRATCH zone)

EMBL: CP000423.PE346

CP000423.PE346       Location/Qualifiers
FT   CDS             353626..354336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0353"
FT                   /product="CRISPR-associated protein, Cas5e family"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69212"
FT                   /db_xref="GOA:Q03C60"
FT                   /db_xref="InterPro:IPR010147"
FT                   /db_xref="InterPro:IPR013422"
FT                   /db_xref="InterPro:IPR021124"
FT                   /db_xref="UniProtKB/TrEMBL:Q03C60"
FT                   /protein_id="ABJ69212.1"
FT                   /translation="MKTISIRLTSPLQSYGNEAQFARRTTGDYPSKSAIIGMLAAALGY
FT                   QRDDPAINALNDLLFAVRVDQPGQVMTEFQTAEWKPGTRKLTYRDLLQDAVFVVAIGSE
FT                   DEAWLDRLAEALRHPRFQLYLGRRANVPAGVLKIQTFAGQDPVGVLAQLPWQASRWYQR
FT                   RSRRQASMSVQLIADAVLLPERRADLVRDAVHSFDQKHRQYSFRPIAVTKVQLANPEYK
FT                   PAPTATAQDAFGQV"
     MKTISIRLTS PLQSYGNEAQ FARRTTGDYP SKSAIIGMLA AALGYQRDDP AINALNDLLF        60
     AVRVDQPGQV MTEFQTAEWK PGTRKLTYRD LLQDAVFVVA IGSEDEAWLD RLAEALRHPR       120
     FQLYLGRRAN VPAGVLKIQT FAGQDPVGVL AQLPWQASRW YQRRSRRQAS MSVQLIADAV       180
     LLPERRADLV RDAVHSFDQK HRQYSFRPIA VTKVQLANPE YKPAPTATAQ DAFGQV           236
//

If you have problems or comments...

PBIL Back to PBIL home page