(data stored in SCRATCH zone)

EMBL: CP000423.PE405

CP000423.PE405       Location/Qualifiers
FT   CDS             complement(421584..422564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0415"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69271"
FT                   /db_xref="UniProtKB/TrEMBL:Q03C01"
FT                   /protein_id="ABJ69271.1"
FT                   /translation="MDYELKLRRHASREIDKYWENFQKSTSYQHLLTVPGFSQVPPDEI
FT                   RLILVTFFVHAFDNLRSTIQALDTEHVAAGLQETLQTYHDDALDRSESLAIAAELLKTF
FT                   MIWLIATNEIKLTILEFVDALMNVFVTATYLLGLTEEEALTSPFGNDDFDLPGVDDAFS
FT                   DPDNDVDFDSENMAELFQLTMTFLESKTWLQVPKPVQNQELFGATTLFLAHTIQSLFGH
FT                   DPKNWTAQDIKAAMSMLLYDKKTIGPDQRAVIGQMVAIFIRSTTTSHLWTPTQRQALAT
FT                   AAESRVQELVAAKPAPQQPTSNPTETTTNNRVVPIAGWQKHKHDK"
     MDYELKLRRH ASREIDKYWE NFQKSTSYQH LLTVPGFSQV PPDEIRLILV TFFVHAFDNL        60
     RSTIQALDTE HVAAGLQETL QTYHDDALDR SESLAIAAEL LKTFMIWLIA TNEIKLTILE       120
     FVDALMNVFV TATYLLGLTE EEALTSPFGN DDFDLPGVDD AFSDPDNDVD FDSENMAELF       180
     QLTMTFLESK TWLQVPKPVQ NQELFGATTL FLAHTIQSLF GHDPKNWTAQ DIKAAMSMLL       240
     YDKKTIGPDQ RAVIGQMVAI FIRSTTTSHL WTPTQRQALA TAAESRVQEL VAAKPAPQQP       300
     TSNPTETTTN NRVVPIAGWQ KHKHDK                                            326
//

If you have problems or comments...

PBIL Back to PBIL home page