(data stored in SCRATCH zone)

EMBL: CP000423.PE41

CP000423.PE41        Location/Qualifiers
FT   CDS             complement(39716..41092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0041"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ68907"
FT                   /db_xref="InterPro:IPR015020"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q03D15"
FT                   /protein_id="ABJ68907.1"
FT                   /translation="MKYPNETSGTADYTVIKGLVTSNGDTGHDSIALDTATQLTAEDVK
FT                   HFRDYGFSIVGRYLTGTVGTDYKPKNLTSTEIKTILDGGMKFFPIYEDGGYVESYFTAS
FT                   QGQKDAQTAIKTALDLELPAGTVIYFAVDVDFQDGDIDGTVIPYIKAIQNILSQSIYKT
FT                   GIYGTRNVCLHAERVGIGFSFVANMSYGWSGNLGFKMPDNWAFDQFVEYPIYGIDIDQT
FT                   ASSGLDKGISGVAQTTPEVQTGYLANQLLSVFPDYHNLFGTINWTVSAPEQHLSTPIAD
FT                   YYITLEDKWIATVVDDKTGTLTIQDAKMLNQTADVMKQFESAMSSYDIGDLSGAFNKLA
FT                   PMIGNGAIKAGLAIRDGMVGFKIAIEGSFESSTSSSSVEGKYTLTLETYIHRDQVPKNA
FT                   YDPVYQPVTEPNPVFAVDLGKVATTVVIGLLVSSMLPEVGGGAALVELFNVVKTIFAVA
FT                   "
     MKYPNETSGT ADYTVIKGLV TSNGDTGHDS IALDTATQLT AEDVKHFRDY GFSIVGRYLT        60
     GTVGTDYKPK NLTSTEIKTI LDGGMKFFPI YEDGGYVESY FTASQGQKDA QTAIKTALDL       120
     ELPAGTVIYF AVDVDFQDGD IDGTVIPYIK AIQNILSQSI YKTGIYGTRN VCLHAERVGI       180
     GFSFVANMSY GWSGNLGFKM PDNWAFDQFV EYPIYGIDID QTASSGLDKG ISGVAQTTPE       240
     VQTGYLANQL LSVFPDYHNL FGTINWTVSA PEQHLSTPIA DYYITLEDKW IATVVDDKTG       300
     TLTIQDAKML NQTADVMKQF ESAMSSYDIG DLSGAFNKLA PMIGNGAIKA GLAIRDGMVG       360
     FKIAIEGSFE SSTSSSSVEG KYTLTLETYI HRDQVPKNAY DPVYQPVTEP NPVFAVDLGK       420
     VATTVVIGLL VSSMLPEVGG GAALVELFNV VKTIFAVA                               458
//

If you have problems or comments...

PBIL Back to PBIL home page