(data stored in SCRATCH zone)

EMBL: CP000423.PE413

CP000423.PE413       Location/Qualifiers
FT   CDS             complement(427685..428113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0423"
FT                   /product="Predicted redox protein, regulator of disulfide
FT                   bond formation"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69279"
FT                   /db_xref="GOA:Q03BZ3"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019953"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="PDB:2QL8"
FT                   /db_xref="UniProtKB/TrEMBL:Q03BZ3"
FT                   /protein_id="ABJ69279.1"
FT                   /translation="MQDERWNHPLYTTTAINDEELEGHAYIPGGLKVQTSSPMNDHPGT
FT                   NPEQLLGLSLSTCLEATLEAVEKEHGLPHTGAVRVKVAFIGARAEYQFLVHAQVMVKGV
FT                   DFDTAKAFTNEIENRCPVSKLLKNSGNYTIETVTDFKD"
     MQDERWNHPL YTTTAINDEE LEGHAYIPGG LKVQTSSPMN DHPGTNPEQL LGLSLSTCLE        60
     ATLEAVEKEH GLPHTGAVRV KVAFIGARAE YQFLVHAQVM VKGVDFDTAK AFTNEIENRC       120
     PVSKLLKNSG NYTIETVTDF KD                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page