(data stored in SCRATCH zone)

EMBL: CP000423.PE446

CP000423.PE446       Location/Qualifiers
FT   CDS             465453..467069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0459"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69312"
FT                   /db_xref="GOA:Q03BW0"
FT                   /db_xref="UniProtKB/TrEMBL:Q03BW0"
FT                   /protein_id="ABJ69312.1"
FT                   /translation="MAEAWRYYWFQAQVDATTMVNGLIYFIRRLPILGKKIPTKLYRMG
FT                   AVKSLIAIIMSCLMFMMKPLIAMLLLAMDFLVANAYNDFIHPLPTTFTFRTMVAVTIYT
FT                   LGGLLFRGLVFRYIPVDLKAIKLADYFVLDRLALARGLTRIQQVIGIVLGPFLPFFGLT
FT                   MITQNYWILFVGLGVSVFSWFWRGFIPRLTWSNHRLGMIAQILYWCGLVGVPIALVLSG
FT                   KLTPFVTGLFSPIGLIICWIGVFGLWWYQHRFSNDIPLLMASIQQSVITLNKVAATQKQ
FT                   QFLATGTAMQKKLTLDTTVSVKVNQRLGNNYLNALLFARYRSQLWKKLRTRVLWISGIG
FT                   ISGLILLKLFAIHSVGDLTPIYGALFFVMYLASLGGPIVQLLFVNCDSAMLFYPFYRQP
FT                   KAVLSGFFYRFWRIVQYNAVTGALIYGLLLALQLVTPVPDHLNFYLVLLLEVCGMVLFF
FT                   SFHDLFIYYLLQPFTEDMEVVSPLYRILYWAMYWVAWVFTQVHLSGYTYALAIGVITCI
FT                   YVVAGTIVIYRVAPKTFRIRY"
     MAEAWRYYWF QAQVDATTMV NGLIYFIRRL PILGKKIPTK LYRMGAVKSL IAIIMSCLMF        60
     MMKPLIAMLL LAMDFLVANA YNDFIHPLPT TFTFRTMVAV TIYTLGGLLF RGLVFRYIPV       120
     DLKAIKLADY FVLDRLALAR GLTRIQQVIG IVLGPFLPFF GLTMITQNYW ILFVGLGVSV       180
     FSWFWRGFIP RLTWSNHRLG MIAQILYWCG LVGVPIALVL SGKLTPFVTG LFSPIGLIIC       240
     WIGVFGLWWY QHRFSNDIPL LMASIQQSVI TLNKVAATQK QQFLATGTAM QKKLTLDTTV       300
     SVKVNQRLGN NYLNALLFAR YRSQLWKKLR TRVLWISGIG ISGLILLKLF AIHSVGDLTP       360
     IYGALFFVMY LASLGGPIVQ LLFVNCDSAM LFYPFYRQPK AVLSGFFYRF WRIVQYNAVT       420
     GALIYGLLLA LQLVTPVPDH LNFYLVLLLE VCGMVLFFSF HDLFIYYLLQ PFTEDMEVVS       480
     PLYRILYWAM YWVAWVFTQV HLSGYTYALA IGVITCIYVV AGTIVIYRVA PKTFRIRY         538
//

If you have problems or comments...

PBIL Back to PBIL home page