(data stored in SCRATCH zone)

EMBL: CP000423.PE448

CP000423.PE448       Location/Qualifiers
FT   CDS             468051..469166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0461"
FT                   /product="Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69314"
FT                   /db_xref="GOA:Q03BV8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008358"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q03BV8"
FT                   /protein_id="ABJ69314.1"
FT                   /translation="MDKLKQRLTRLPIKKALPHLILIGTIAAALVVLVYLLIWHVVMMP
FT                   IATALAKRWFIGGMSLYFGGAIIGSFAMLYAVMNVTARLFYRVKLGPPLDQLQYGVTHI
FT                   QAQDLDFTLQPTSDDELGQLVAAFEEMRQALRKALETAWQLADDQKQVNAAFAHDLRTP
FT                   LTVLQGNLELLTFNEEGQPPDQHLLDEMQRQLDRMNNFIKTMSHVTSIQNIRLNHHAIT
FT                   EAQVEQQLRSEVDKLPTAKTIGWQVDSTRLTDNKLSVSPDAILEVFDNQINNALRFAKT
FT                   KVGIHLTFNDQQITLQVCNDGQPLTATEQRKVKLPYFSNDKAAHHLGVGMYICNQLCAA
FT                   HRGYFKIQNREHAAGVCSTAVFGYFDGSAES"
     MDKLKQRLTR LPIKKALPHL ILIGTIAAAL VVLVYLLIWH VVMMPIATAL AKRWFIGGMS        60
     LYFGGAIIGS FAMLYAVMNV TARLFYRVKL GPPLDQLQYG VTHIQAQDLD FTLQPTSDDE       120
     LGQLVAAFEE MRQALRKALE TAWQLADDQK QVNAAFAHDL RTPLTVLQGN LELLTFNEEG       180
     QPPDQHLLDE MQRQLDRMNN FIKTMSHVTS IQNIRLNHHA ITEAQVEQQL RSEVDKLPTA       240
     KTIGWQVDST RLTDNKLSVS PDAILEVFDN QINNALRFAK TKVGIHLTFN DQQITLQVCN       300
     DGQPLTATEQ RKVKLPYFSN DKAAHHLGVG MYICNQLCAA HRGYFKIQNR EHAAGVCSTA       360
     VFGYFDGSAE S                                                            371
//

If you have problems or comments...

PBIL Back to PBIL home page