(data stored in SCRATCH zone)

EMBL: CP000423.PE45

CP000423.PE45        Location/Qualifiers
FT   CDS             43819..44091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0046"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ68911"
FT                   /db_xref="GOA:Q03D11"
FT                   /db_xref="InterPro:IPR008407"
FT                   /db_xref="UniProtKB/TrEMBL:Q03D11"
FT                   /protein_id="ABJ68911.1"
FT                   /translation="MRVVPIVLVKRMTIPKWLLHFLSFVPVAILSAIFVESLLVIHPGQ
FT                   WPGVNWSNLLASLPAIAVAIITKSLFAVVVAGVASMAILRLLGWA"
     MRVVPIVLVK RMTIPKWLLH FLSFVPVAIL SAIFVESLLV IHPGQWPGVN WSNLLASLPA        60
     IAVAIITKSL FAVVVAGVAS MAILRLLGWA                                         90
//

If you have problems or comments...

PBIL Back to PBIL home page