(data stored in SCRATCH zone)

EMBL: CP000423.PE456

CP000423.PE456       Location/Qualifiers
FT   CDS             488439..489881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0471"
FT                   /product="amino acid/polyamine/organocation transporter,
FT                   APC superfamily"
FT                   /note="TC 2.A.3"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69322"
FT                   /db_xref="GOA:Q03BV0"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q03BV0"
FT                   /protein_id="ABJ69322.1"
FT                   /translation="MADTKKQLRWYNVALIAFVSVWGLGNVFNNYAQQGLSVVTSWILI
FT                   MAIYFVPYALIVGQLGSTFKDQAGGVSSWIKETGTVRLAYYAAWTYWVVHIPYLAQKPQ
FT                   AILIALSWLFKGNGNFVNTVSSMTVSLICLALFLLFLWLSSRGLTTLNRIGSMAGTAMF
FT                   LMSILFIILAVTAPLMVKGVHVATPDMGDIHTYLPKFDLNYFTTISMLVFAVGGAEKIS
FT                   PYVNNTKHAAKEFPTGMLVLAGMVAFCALLGSFGMGMLFNSNQIPTDLMANGPYTAFAM
FT                   LGSYYHVGNIFVILYAIANALASISALAFSIDAPLKMLLSDADPHFIPKKLSHLNKKGT
FT                   PINGYWLTGILVSLLIIVPALGIGNMNELYKWLLNLNSVVMPLRYLWVFLAYYLLNKHL
FT                   EKFQAEYMFVKNKHVGMIIGGWCFLFTALACLLGMLPKINYLNDPGTWWFQMGLNIITP
FT                   VIFLALGLILPFIARRDEARLL"
     MADTKKQLRW YNVALIAFVS VWGLGNVFNN YAQQGLSVVT SWILIMAIYF VPYALIVGQL        60
     GSTFKDQAGG VSSWIKETGT VRLAYYAAWT YWVVHIPYLA QKPQAILIAL SWLFKGNGNF       120
     VNTVSSMTVS LICLALFLLF LWLSSRGLTT LNRIGSMAGT AMFLMSILFI ILAVTAPLMV       180
     KGVHVATPDM GDIHTYLPKF DLNYFTTISM LVFAVGGAEK ISPYVNNTKH AAKEFPTGML       240
     VLAGMVAFCA LLGSFGMGML FNSNQIPTDL MANGPYTAFA MLGSYYHVGN IFVILYAIAN       300
     ALASISALAF SIDAPLKMLL SDADPHFIPK KLSHLNKKGT PINGYWLTGI LVSLLIIVPA       360
     LGIGNMNELY KWLLNLNSVV MPLRYLWVFL AYYLLNKHLE KFQAEYMFVK NKHVGMIIGG       420
     WCFLFTALAC LLGMLPKINY LNDPGTWWFQ MGLNIITPVI FLALGLILPF IARRDEARLL       480
//

If you have problems or comments...

PBIL Back to PBIL home page