(data stored in SCRATCH zone)

EMBL: CP000423.PE457

CP000423.PE457       Location/Qualifiers
FT   CDS             complement(489993..490496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0472"
FT                   /product="Predicted periplasmic/secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69323"
FT                   /db_xref="GOA:Q03BU9"
FT                   /db_xref="InterPro:IPR009898"
FT                   /db_xref="UniProtKB/TrEMBL:Q03BU9"
FT                   /protein_id="ABJ69323.1"
FT                   /translation="MRTQTKTSVMKLAAVGAVAGLVSGLVKLGWENILPPRTPERDATN
FT                   PPQTFLQQHGLTAAQTHATYTYSDHQIPWVSLLIHFGFSSSLGALYAVAGHYVPLFKLG
FT                   YGSMWGLGVWAGAHLWAMPALKIVPAAKDQPVEEHLSEAVGHMVWNTVNQIVISDMLRE
FT                   KSGN"
     MRTQTKTSVM KLAAVGAVAG LVSGLVKLGW ENILPPRTPE RDATNPPQTF LQQHGLTAAQ        60
     THATYTYSDH QIPWVSLLIH FGFSSSLGAL YAVAGHYVPL FKLGYGSMWG LGVWAGAHLW       120
     AMPALKIVPA AKDQPVEEHL SEAVGHMVWN TVNQIVISDM LREKSGN                     167
//

If you have problems or comments...

PBIL Back to PBIL home page