(data stored in SCRATCH zone)

EMBL: CP000423.PE469

CP000423.PE469       Location/Qualifiers
FT   CDS             complement(500570..500938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0484"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69335"
FT                   /db_xref="GOA:Q03BT7"
FT                   /db_xref="UniProtKB/TrEMBL:Q03BT7"
FT                   /protein_id="ABJ69335.1"
FT                   /translation="MSQIILLIAALFFFTRHVFRFERISRLTLVIIPAYTLVTGILLVS
FT                   HKRPTFLALGVTILIGAILGWFQTTGLKIHVSQKHDVNGLPIIEIRHGWQYLVGWMARM
FT                   SMVRTKIVRFCRMRMVVT"
     MSQIILLIAA LFFFTRHVFR FERISRLTLV IIPAYTLVTG ILLVSHKRPT FLALGVTILI        60
     GAILGWFQTT GLKIHVSQKH DVNGLPIIEI RHGWQYLVGW MARMSMVRTK IVRFCRMRMV       120
     VT                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page