(data stored in SCRATCH zone)

EMBL: CP000423.PE47

CP000423.PE47        Location/Qualifiers
FT   CDS             45426..45536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0048"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ68913"
FT                   /db_xref="UniProtKB/TrEMBL:Q03D09"
FT                   /protein_id="ABJ68913.1"
FT                   /translation="MTLSVITNKQAAPSRTEKVHDSGACFLVMIKLNSRI"
     MTLSVITNKQ AAPSRTEKVH DSGACFLVMI KLNSRI                                  36
//

If you have problems or comments...

PBIL Back to PBIL home page