(data stored in SCRATCH zone)

EMBL: CP000423.PE473

CP000423.PE473       Location/Qualifiers
FT   CDS             complement(503495..503731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0489"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69339"
FT                   /db_xref="UniProtKB/TrEMBL:Q03BT3"
FT                   /protein_id="ABJ69339.1"
FT                   /translation="MLAGYKKPPAAVVEEQLDYVEEKKLQKDNSDKAKSLPDKKSGLFF
FT                   DRNVQNRSIKLVHKDPVPPKPKMPDSASSKNKD"
     MLAGYKKPPA AVVEEQLDYV EEKKLQKDNS DKAKSLPDKK SGLFFDRNVQ NRSIKLVHKD        60
     PVPPKPKMPD SASSKNKD                                                      78
//

If you have problems or comments...

PBIL Back to PBIL home page