(data stored in SCRATCH zone)

EMBL: CP000423.PE482

CP000423.PE482       Location/Qualifiers
FT   CDS             507916..508095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0498"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69348"
FT                   /db_xref="UniProtKB/TrEMBL:Q03BS4"
FT                   /protein_id="ABJ69348.1"
FT                   /translation="MNERPKEKLTNVVKVQDKDVEDQVTGMVIDLLKQKGFTFANFESV
FT                   VARVKSHYQNNATI"
     MNERPKEKLT NVVKVQDKDV EDQVTGMVID LLKQKGFTFA NFESVVARVK SHYQNNATI         59
//

If you have problems or comments...

PBIL Back to PBIL home page