(data stored in SCRATCH zone)

EMBL: CP000423.PE492

CP000423.PE492       Location/Qualifiers
FT   CDS             511881..512705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0508"
FT                   /product="DNA replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69358"
FT                   /db_xref="GOA:Q03BR4"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q03BR4"
FT                   /protein_id="ABJ69358.1"
FT                   /translation="MSNLETNQGRLAAIETFAERCPDCGSLLYRPKGLSKVTGKKMAGV
FT                   CMNCGYKQPPTEPKNVTPDMEKEARKNRTVGYYLAYSVFSTDAIIAKDFNNFHTDGSLG
FT                   QQQLKLFAVGLSNKICRNEVVHALIIGDTGVGKSHIANGILIDTQAKTGYRKTCLFIDW
FT                   NALMQRLKSGMSANAQDVRMKNEKIMHEIGKADVVVIDDLGSERGSDFDRQTADDVFRM
FT                   REDKATIVTTNLHGQDLNKRYGERTMSRMAKHGQGNSFGVKGILDQRKEALP"
     MSNLETNQGR LAAIETFAER CPDCGSLLYR PKGLSKVTGK KMAGVCMNCG YKQPPTEPKN        60
     VTPDMEKEAR KNRTVGYYLA YSVFSTDAII AKDFNNFHTD GSLGQQQLKL FAVGLSNKIC       120
     RNEVVHALII GDTGVGKSHI ANGILIDTQA KTGYRKTCLF IDWNALMQRL KSGMSANAQD       180
     VRMKNEKIMH EIGKADVVVI DDLGSERGSD FDRQTADDVF RMREDKATIV TTNLHGQDLN       240
     KRYGERTMSR MAKHGQGNSF GVKGILDQRK EALP                                   274
//

If you have problems or comments...

PBIL Back to PBIL home page