(data stored in SCRATCH zone)

EMBL: CP000423.PE495

CP000423.PE495       Location/Qualifiers
FT   CDS             513694..514431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0511"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69361"
FT                   /db_xref="UniProtKB/TrEMBL:Q03BR1"
FT                   /protein_id="ABJ69361.1"
FT                   /translation="MTTEADALKFTAEQAVTANGKRIIETKNRQFLINGNGDIREFRPN
FT                   DGANEALQVHTLTAVVDYIGKVSERSASPLIVQVVDENSVFVLGELDDFGNREVLIKAK
FT                   AMHPCYPYGQWLDSESFIIALQAQFMTTEDGKVLLKFVGNLKDESAQTMVDDGVSQVAT
FT                   ARSGVASVGKVVVPNPISLRPYRTFLEVEQQESDFVFRMHEGPKLALFSADGDAWRNTA
FT                   IDLVAEYLSEKLVKFSKHVTVLA"
     MTTEADALKF TAEQAVTANG KRIIETKNRQ FLINGNGDIR EFRPNDGANE ALQVHTLTAV        60
     VDYIGKVSER SASPLIVQVV DENSVFVLGE LDDFGNREVL IKAKAMHPCY PYGQWLDSES       120
     FIIALQAQFM TTEDGKVLLK FVGNLKDESA QTMVDDGVSQ VATARSGVAS VGKVVVPNPI       180
     SLRPYRTFLE VEQQESDFVF RMHEGPKLAL FSADGDAWRN TAIDLVAEYL SEKLVKFSKH       240
     VTVLA                                                                   245
//

If you have problems or comments...

PBIL Back to PBIL home page