(data stored in SCRATCH zone)

EMBL: CP000423.PE499

CP000423.PE499       Location/Qualifiers
FT   CDS             516604..517257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0515"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69365"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q03BQ7"
FT                   /protein_id="ABJ69365.1"
FT                   /translation="MSFISGFLTKDFCSIVANGRMSQGAKTVGENYKKFMLAESNILIA
FT                   TTGNAQVADIIKDFIKRLHVQSNGAQLNWQLYVNVIQQFVKETLKEAKDIDGNCVNQIV
FT                   VICGVNGNKIMALAFGQTDAGYIQREYLPGENEQKFFTMTPPGVNPDAVTKEFISITNK
FT                   IEIRTYSDIVIVQSKLQDYVAEIDSGKSVNTHKMGMGARIDGINGRFKEWSSGN"
     MSFISGFLTK DFCSIVANGR MSQGAKTVGE NYKKFMLAES NILIATTGNA QVADIIKDFI        60
     KRLHVQSNGA QLNWQLYVNV IQQFVKETLK EAKDIDGNCV NQIVVICGVN GNKIMALAFG       120
     QTDAGYIQRE YLPGENEQKF FTMTPPGVNP DAVTKEFISI TNKIEIRTYS DIVIVQSKLQ       180
     DYVAEIDSGK SVNTHKMGMG ARIDGINGRF KEWSSGN                                217
//

If you have problems or comments...

PBIL Back to PBIL home page