(data stored in SCRATCH zone)

EMBL: CP000423.PE504

CP000423.PE504       Location/Qualifiers
FT   CDS             520453..520788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69370"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q03BQ2"
FT                   /protein_id="ABJ69370.1"
FT                   /translation="MNSTNAMKRVGYGYVSHTEQAIIEKLSREEKHMQAIIYTKPHCQK
FT                   CRRTVFKLSRVMPVQTITADADDYERFRKLGYRSMPVVTIYEADGTHDEWCDLRVDKIK
FT                   QYTEGNI"
     MNSTNAMKRV GYGYVSHTEQ AIIEKLSREE KHMQAIIYTK PHCQKCRRTV FKLSRVMPVQ        60
     TITADADDYE RFRKLGYRSM PVVTIYEADG THDEWCDLRV DKIKQYTEGN I                111
//

If you have problems or comments...

PBIL Back to PBIL home page