(data stored in SCRATCH zone)

EMBL: CP000423.PE520

CP000423.PE520       Location/Qualifiers
FT   CDS             533639..534235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0537"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69386"
FT                   /db_xref="UniProtKB/TrEMBL:Q03BN6"
FT                   /protein_id="ABJ69386.1"
FT                   /translation="MATKFDAVEARKRQKEAAKKKERKDGVGRIYPVVGITNSGYIKLA
FT                   HNGLMFYADIFKPKSFDLFELSVQDADQIESELWGLHQQYPGSIKELYMNFPETNQRQQ
FT                   TYFRRKIEQTRNPIYLELLQHDLAVLKQLEKTYRKLSSWIWFFGDSVPELERNLELARH
FT                   ASTLYTFERAGLAEKEKMLQMMNNPEVSVSETEEA"
     MATKFDAVEA RKRQKEAAKK KERKDGVGRI YPVVGITNSG YIKLAHNGLM FYADIFKPKS        60
     FDLFELSVQD ADQIESELWG LHQQYPGSIK ELYMNFPETN QRQQTYFRRK IEQTRNPIYL       120
     ELLQHDLAVL KQLEKTYRKL SSWIWFFGDS VPELERNLEL ARHASTLYTF ERAGLAEKEK       180
     MLQMMNNPEV SVSETEEA                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page