(data stored in SCRATCH zone)

EMBL: CP000423.PE523

CP000423.PE523       Location/Qualifiers
FT   CDS             537172..537816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69389"
FT                   /db_xref="UniProtKB/TrEMBL:Q03BN3"
FT                   /protein_id="ABJ69389.1"
FT                   /translation="MNRKTMLVSVMMILALGAGAYGWASANTANKNISQQKQELRIMAS
FT                   KNESLETQLEALKISNQVNHASSNSDSASKKANTTSSQSDNLTDTTQKISAMMNGLLQG
FT                   MYSPKKATTMGQYEAMKPYLTGEAIQTFMPDRDTPISANGFQESTINDLRVFVTPQGDD
FT                   YLLMARYELGNNKTNTNKKTTMVFQGTVRKVSNDYKLAAFDSNRALSGVTP"
     MNRKTMLVSV MMILALGAGA YGWASANTAN KNISQQKQEL RIMASKNESL ETQLEALKIS        60
     NQVNHASSNS DSASKKANTT SSQSDNLTDT TQKISAMMNG LLQGMYSPKK ATTMGQYEAM       120
     KPYLTGEAIQ TFMPDRDTPI SANGFQESTI NDLRVFVTPQ GDDYLLMARY ELGNNKTNTN       180
     KKTTMVFQGT VRKVSNDYKL AAFDSNRALS GVTP                                   214
//

If you have problems or comments...

PBIL Back to PBIL home page