(data stored in SCRATCH zone)

EMBL: CP000423.PE526

CP000423.PE526       Location/Qualifiers
FT   CDS             539634..539813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0543"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69392"
FT                   /db_xref="UniProtKB/TrEMBL:Q03BN0"
FT                   /protein_id="ABJ69392.1"
FT                   /translation="MDKQNETRRVMMTLSDQAIAKLDHLVAEKQRELNQNPELAKYNLR
FT                   LNKSNILEAWLSKQ"
     MDKQNETRRV MMTLSDQAIA KLDHLVAEKQ RELNQNPELA KYNLRLNKSN ILEAWLSKQ         59
//

If you have problems or comments...

PBIL Back to PBIL home page