(data stored in SCRATCH zone)

EMBL: CP000423.PE531

CP000423.PE531       Location/Qualifiers
FT   CDS             542046..544589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0548"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69397"
FT                   /db_xref="InterPro:IPR025054"
FT                   /db_xref="UniProtKB/TrEMBL:Q03BM5"
FT                   /protein_id="ABJ69397.1"
FT                   /translation="MARTKAEIKAWEHEMAQRATEQLSALADTQKFKQYLRQNAAFHGY
FT                   SVRNVLLINMQHPNATRVAGFKQWDKLGRHIRKGEHAIKITMPIVKKLTPEEQVKYKTT
FT                   AERAIVGYRYGSVFDVSQTNGKALLSATDFIKERLGDHQNVDRLYHAVVDAINTEGHVK
FT                   VSEAPIDEPGVRGFFRPSTQEIVISPQETDAAMKLKTLFHEYGHSQLHGIGQAFADRPR
FT                   AWKEAQAESVAYIAMQNIGIDTGDYSLGYVATWAKDPKVMAQALKEINEASVHTIELSD
FT                   QAAQALGFDQAQTAEATLNDAPEQTTNLNSGKRERLTQSEINRARKLSLVDIARSAGID
FT                   LKEDSRDYYRGVDHDSLVIDAKKNLWKWNSQNLGGGAIEFATTFLDQKGFYQAVKFLNA
FT                   GHYGETKIQTAPKAAYHNYLKRADSFDRARDYLTIARGINPHLVDRLYQKGLIFQDSQN
FT                   NLIFQWARNGKAVGASIQGTEIDFKNYGKRGTQKKIAANSQSDFGFNFSLGKPQDLYVF
FT                   ESPIDALSYWTQHPELTNCMIASVDGTKVESVVNMAVNMYKTKGQLPATIYVGSDNDPA
FT                   GHQLYDKLQDSILANTEAEVTTFKPLFPQDNAITQTTYQGLKQAADQAGIDWRELAAAA
FT                   KATTNLSTNYQQAFPLPQAIAKSSVLIDPNPGKTNFNSDEALLTAAKFIKANRTDDNKP
FT                   NWNAITKKLNPGIEDHDRDHLAAKSSYYNTRYQADNGILPVSKIAKDWNELAKLAQHPA
FT                   AMDQQLEKTYRRQDGKTAKLIVNGQDQFSLVDRKQPDKVVGYFEANDPQQCAYLIKQYG
FT                   YNAVDKEDEQKYQQTQPVKPQQHKKQRAAGPEQSM"
     MARTKAEIKA WEHEMAQRAT EQLSALADTQ KFKQYLRQNA AFHGYSVRNV LLINMQHPNA        60
     TRVAGFKQWD KLGRHIRKGE HAIKITMPIV KKLTPEEQVK YKTTAERAIV GYRYGSVFDV       120
     SQTNGKALLS ATDFIKERLG DHQNVDRLYH AVVDAINTEG HVKVSEAPID EPGVRGFFRP       180
     STQEIVISPQ ETDAAMKLKT LFHEYGHSQL HGIGQAFADR PRAWKEAQAE SVAYIAMQNI       240
     GIDTGDYSLG YVATWAKDPK VMAQALKEIN EASVHTIELS DQAAQALGFD QAQTAEATLN       300
     DAPEQTTNLN SGKRERLTQS EINRARKLSL VDIARSAGID LKEDSRDYYR GVDHDSLVID       360
     AKKNLWKWNS QNLGGGAIEF ATTFLDQKGF YQAVKFLNAG HYGETKIQTA PKAAYHNYLK       420
     RADSFDRARD YLTIARGINP HLVDRLYQKG LIFQDSQNNL IFQWARNGKA VGASIQGTEI       480
     DFKNYGKRGT QKKIAANSQS DFGFNFSLGK PQDLYVFESP IDALSYWTQH PELTNCMIAS       540
     VDGTKVESVV NMAVNMYKTK GQLPATIYVG SDNDPAGHQL YDKLQDSILA NTEAEVTTFK       600
     PLFPQDNAIT QTTYQGLKQA ADQAGIDWRE LAAAAKATTN LSTNYQQAFP LPQAIAKSSV       660
     LIDPNPGKTN FNSDEALLTA AKFIKANRTD DNKPNWNAIT KKLNPGIEDH DRDHLAAKSS       720
     YYNTRYQADN GILPVSKIAK DWNELAKLAQ HPAAMDQQLE KTYRRQDGKT AKLIVNGQDQ       780
     FSLVDRKQPD KVVGYFEAND PQQCAYLIKQ YGYNAVDKED EQKYQQTQPV KPQQHKKQRA       840
     AGPEQSM                                                                 847
//

If you have problems or comments...

PBIL Back to PBIL home page