(data stored in SCRATCH zone)

EMBL: CP000423.PE545

CP000423.PE545       Location/Qualifiers
FT   CDS             554207..554539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0563"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69411"
FT                   /db_xref="GOA:Q03BL1"
FT                   /db_xref="UniProtKB/TrEMBL:Q03BL1"
FT                   /protein_id="ABJ69411.1"
FT                   /translation="MTIDEMTKGYEKEVAYQKHMLKNLGYWFQLCTILSGVGIVLIYFF
FT                   HGKTLWLNIVGIVLIVLGALGMLMFGYSGWKGQQNVRAVVDDYDKKIKYFQKKVRQQTG
FT                   ITPKAK"
     MTIDEMTKGY EKEVAYQKHM LKNLGYWFQL CTILSGVGIV LIYFFHGKTL WLNIVGIVLI        60
     VLGALGMLMF GYSGWKGQQN VRAVVDDYDK KIKYFQKKVR QQTGITPKAK                  110
//

If you have problems or comments...

PBIL Back to PBIL home page