(data stored in SCRATCH zone)

EMBL: CP000423.PE554

CP000423.PE554       Location/Qualifiers
FT   CDS             564305..564544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0574"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69420"
FT                   /db_xref="InterPro:IPR009620"
FT                   /db_xref="UniProtKB/TrEMBL:Q03BK2"
FT                   /protein_id="ABJ69420.1"
FT                   /translation="MLEQQDQVLADSSYRKQFFKIKDMRERHVDTSIGTVSFRRRYYED
FT                   VRTNERIFLLDEQIGLEKSSRLGLDLKAKLLEPV"
     MLEQQDQVLA DSSYRKQFFK IKDMRERHVD TSIGTVSFRR RYYEDVRTNE RIFLLDEQIG        60
     LEKSSRLGLD LKAKLLEPV                                                     79
//

If you have problems or comments...

PBIL Back to PBIL home page