(data stored in SCRATCH zone)

EMBL: CP000423.PE567

CP000423.PE567       Location/Qualifiers
FT   CDS             complement(578621..578869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0588"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69433"
FT                   /db_xref="InterPro:IPR013560"
FT                   /db_xref="UniProtKB/TrEMBL:Q03BI9"
FT                   /protein_id="ABJ69433.1"
FT                   /translation="MNWQKVWAVNKYWVMSKSQQQYDYIRLLAKNNQWTPQKTQELGNI
FT                   IDSLESVSPTKQTLTTTYQHIWGYFKKNVPMKSYISI"
     MNWQKVWAVN KYWVMSKSQQ QYDYIRLLAK NNQWTPQKTQ ELGNIIDSLE SVSPTKQTLT        60
     TTYQHIWGYF KKNVPMKSYI SI                                                 82
//

If you have problems or comments...

PBIL Back to PBIL home page