(data stored in SCRATCH zone)

EMBL: CP000423.PE58

CP000423.PE58        Location/Qualifiers
FT   CDS             complement(55706..59017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0060"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ68924"
FT                   /db_xref="GOA:Q03CZ8"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="InterPro:IPR023908"
FT                   /db_xref="UniProtKB/TrEMBL:Q03CZ8"
FT                   /protein_id="ABJ68924.1"
FT                   /translation="MKNLRHRHIPALIFWLIVIIMTLITMPDVSGIVRDKGALSLPKNE
FT                   ESQIAANIEKKANNNQKVRSYALVFNNGDKKLTASQKQAIHQTLKNLKSTGAVKIINVT
FT                   QASDNAETKKQLDAKDGTTQMALVDVKAQGQVGPQTRNLEKQIKTSNVKTYVTGSDVLN
FT                   DDFATVTEKGIQKTEIIAAIFIFIVLIIVFRSPIVPLVSLLTVAISFMTSLNIIMNLAD
FT                   KFNFPISNFTQVFLVVVLFGIGTDYNILLYDDFKAALSQGIPRTKAAGVARRFGGRTIL
FT                   YSGLSVLIGFSVLGLANFKFYRSAVGVAIGVLILLTVLLTLNMFFMATLGEKLFWPSKN
FT                   LNGHSTSRLWHGLSKMGIARPLITLGIIGIIAVPFLLNANQTLNFNNADELPETLQSKV
FT                   GYKLIQDHYSKGMASPTTIYIQSKQPLNTQTVLGTIDDLTTYLQKENGVKTVASVTQPG
FT                   GSQIKSLYLDNQLQTINAGLTDSVKGLKQVQAGLSSANTQITNADVAGSTQQVQTLANG
FT                   TNTLSSGASSLNSGIGQYTSGVASLNTGIGQLSSQLPALSSGVNTLSTSSTQLAKGMDQ
FT                   LSGNSTVLASGMNQLSDKSGELTSGMNKLASQVQNLTGSAQQIVTLINQLPNGSQLTQS
FT                   ILEEIAKFSGGVQQLTNGTSSLGDGIKTLNNGTTALNSGISTLTSGTHQLSSGIGSLNS
FT                   QVPSLVSGVNQLNTGSSQLAAQNGTLNSGAAQVASGADQVNTGVQTLNTKVKAISEQVT
FT                   TMQSGLTSADKALGTIADGSTSMKQYLTELQKSYLGKKFYIPNATLKSKTFKPALTTYM
FT                   SDGNKITKLTVVLKGDPSTDAAAKQIEAIKTDMTAKLKHTPLADATVAVGGQTSQTADL
FT                   QKLANGDFERTAAIMIIGIGIALIFVTRSLIQPISIISTLLLAYVTSLGLTKLFSTYVL
FT                   GRDMLTWNTPFFTFIMLVALGVDYSIFLMVRYRDNALEGGTMTHRIAKAASVIGAVVIS
FT                   AAIILSGTFAAMIPSGITTLIQVALAVIIGLILLVFLLPLVMSSVISLTDKQMNKNNHP
FT                   QGPGPHDDNDHTSPKSPKTPTPNGPNSSHSATPAEPRTSQKPRVHLAAVPPDSKK"
     MKNLRHRHIP ALIFWLIVII MTLITMPDVS GIVRDKGALS LPKNEESQIA ANIEKKANNN        60
     QKVRSYALVF NNGDKKLTAS QKQAIHQTLK NLKSTGAVKI INVTQASDNA ETKKQLDAKD       120
     GTTQMALVDV KAQGQVGPQT RNLEKQIKTS NVKTYVTGSD VLNDDFATVT EKGIQKTEII       180
     AAIFIFIVLI IVFRSPIVPL VSLLTVAISF MTSLNIIMNL ADKFNFPISN FTQVFLVVVL       240
     FGIGTDYNIL LYDDFKAALS QGIPRTKAAG VARRFGGRTI LYSGLSVLIG FSVLGLANFK       300
     FYRSAVGVAI GVLILLTVLL TLNMFFMATL GEKLFWPSKN LNGHSTSRLW HGLSKMGIAR       360
     PLITLGIIGI IAVPFLLNAN QTLNFNNADE LPETLQSKVG YKLIQDHYSK GMASPTTIYI       420
     QSKQPLNTQT VLGTIDDLTT YLQKENGVKT VASVTQPGGS QIKSLYLDNQ LQTINAGLTD       480
     SVKGLKQVQA GLSSANTQIT NADVAGSTQQ VQTLANGTNT LSSGASSLNS GIGQYTSGVA       540
     SLNTGIGQLS SQLPALSSGV NTLSTSSTQL AKGMDQLSGN STVLASGMNQ LSDKSGELTS       600
     GMNKLASQVQ NLTGSAQQIV TLINQLPNGS QLTQSILEEI AKFSGGVQQL TNGTSSLGDG       660
     IKTLNNGTTA LNSGISTLTS GTHQLSSGIG SLNSQVPSLV SGVNQLNTGS SQLAAQNGTL       720
     NSGAAQVASG ADQVNTGVQT LNTKVKAISE QVTTMQSGLT SADKALGTIA DGSTSMKQYL       780
     TELQKSYLGK KFYIPNATLK SKTFKPALTT YMSDGNKITK LTVVLKGDPS TDAAAKQIEA       840
     IKTDMTAKLK HTPLADATVA VGGQTSQTAD LQKLANGDFE RTAAIMIIGI GIALIFVTRS       900
     LIQPISIIST LLLAYVTSLG LTKLFSTYVL GRDMLTWNTP FFTFIMLVAL GVDYSIFLMV       960
     RYRDNALEGG TMTHRIAKAA SVIGAVVISA AIILSGTFAA MIPSGITTLI QVALAVIIGL      1020
     ILLVFLLPLV MSSVISLTDK QMNKNNHPQG PGPHDDNDHT SPKSPKTPTP NGPNSSHSAT      1080
     PAEPRTSQKP RVHLAAVPPD SKK                                              1103
//

If you have problems or comments...

PBIL Back to PBIL home page