(data stored in SCRATCH zone)

EMBL: CP000423.PE580

CP000423.PE580       Location/Qualifiers
FT   CDS             complement(591877..592590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0602"
FT                   /product="amino acid ABC transporter membrane protein, PAAT
FT                   family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69446"
FT                   /db_xref="GOA:Q03BH6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q03BH6"
FT                   /protein_id="ABJ69446.1"
FT                   /translation="MWKIVADAVPQMAAAGIKYTIPIALVSFAIGLIIALITALTRISV
FT                   RKGFWITFAKGFASFYVWLFRSTPLLVQLFIVFFGLPSLIIPGIFPHGIKLDPVIAGII
FT                   TFSLNTGAYCAETIRAALLSIDHGQWEAAYSVGLPRRLVLREIIIPQALRTAVPPLSNS
FT                   FISLVKDTSLAASITIVEMFQVSQQIAAENYQPLLMYSLVALLYAVVCTVLTWGQRYLE
FT                   KVTSRYTSNVQTTQL"
     MWKIVADAVP QMAAAGIKYT IPIALVSFAI GLIIALITAL TRISVRKGFW ITFAKGFASF        60
     YVWLFRSTPL LVQLFIVFFG LPSLIIPGIF PHGIKLDPVI AGIITFSLNT GAYCAETIRA       120
     ALLSIDHGQW EAAYSVGLPR RLVLREIIIP QALRTAVPPL SNSFISLVKD TSLAASITIV       180
     EMFQVSQQIA AENYQPLLMY SLVALLYAVV CTVLTWGQRY LEKVTSRYTS NVQTTQL          237
//

If you have problems or comments...

PBIL Back to PBIL home page