(data stored in SCRATCH zone)

EMBL: CP000423.PE649

CP000423.PE649       Location/Qualifiers
FT   CDS             complement(677816..678010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0675"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0675"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69515"
FT                   /db_xref="GOA:Q03BA7"
FT                   /db_xref="UniProtKB/TrEMBL:Q03BA7"
FT                   /protein_id="ABJ69515.1"
FT                   /translation="MTARRKTYLLWLALVTFVAIMNGIFKNSLTQVLVMVTACYALYQL
FT                   LKMDHVFDRKKRRENRASR"
     MTARRKTYLL WLALVTFVAI MNGIFKNSLT QVLVMVTACY ALYQLLKMDH VFDRKKRREN        60
     RASR                                                                     64
//

If you have problems or comments...

PBIL Back to PBIL home page