(data stored in SCRATCH zone)

EMBL: CP000423.PE660

CP000423.PE660       Location/Qualifiers
FT   CDS             complement(688777..688899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0686"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0686"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69526"
FT                   /db_xref="UniProtKB/TrEMBL:Q03B96"
FT                   /protein_id="ABJ69526.1"
FT                   /translation="MKTRKPIQKPKHKDLESKTTKALPDIAELRNAQTGPETYA"
     MKTRKPIQKP KHKDLESKTT KALPDIAELR NAQTGPETYA                              40
//

If you have problems or comments...

PBIL Back to PBIL home page