(data stored in SCRATCH zone)

EMBL: CP000423.PE70

CP000423.PE70        Location/Qualifiers
FT   CDS             67999..68583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0072"
FT                   /product="DNA-binding ferritin-like protein (oxidative
FT                   damage protectant)"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ68936"
FT                   /db_xref="GOA:Q03CY6"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:Q03CY6"
FT                   /protein_id="ABJ68936.1"
FT                   /translation="MSVTTGMKSITADQVKEQQAAAAKQADHDHHVPTAGAMSGHVLAN
FT                   LQVLIRKLTQFRVTLRGVASEIDRQLLDQLMQQAQDHFDDLVADLAAQGEDFPTTTAEF
FT                   GEYTMLKEDPAFRFWTNDMKLDAVVNDIDTCQLFVSRAIPLANKENKAVLAADMLQLQR
FT                   WHEQSILRLQTRLGRQVTAGRALLDEDEDDD"
     MSVTTGMKSI TADQVKEQQA AAAKQADHDH HVPTAGAMSG HVLANLQVLI RKLTQFRVTL        60
     RGVASEIDRQ LLDQLMQQAQ DHFDDLVADL AAQGEDFPTT TAEFGEYTML KEDPAFRFWT       120
     NDMKLDAVVN DIDTCQLFVS RAIPLANKEN KAVLAADMLQ LQRWHEQSIL RLQTRLGRQV       180
     TAGRALLDED EDDD                                                         194
//

If you have problems or comments...

PBIL Back to PBIL home page