(data stored in SCRATCH zone)

EMBL: CP000423.PE702

CP000423.PE702       Location/Qualifiers
FT   CDS             complement(730406..730879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0731"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0731"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69568"
FT                   /db_xref="UniProtKB/TrEMBL:Q03B54"
FT                   /protein_id="ABJ69568.1"
FT                   /translation="MKKRYLLLAAILILSGCSQTTSTPKKTTSSSSATSQSHTVKKTVP
FT                   KATLGTLVGHAFVQTKDATKAIRVTSSTSGYYLETLANRDGVFESTDSGIFAADLTLKG
FT                   RIFTFTGRAQPQASANTIQFQLTKTGNLKQLPDGPVYKKVPQDDLDRLAQQNQ"
     MKKRYLLLAA ILILSGCSQT TSTPKKTTSS SSATSQSHTV KKTVPKATLG TLVGHAFVQT        60
     KDATKAIRVT SSTSGYYLET LANRDGVFES TDSGIFAADL TLKGRIFTFT GRAQPQASAN       120
     TIQFQLTKTG NLKQLPDGPV YKKVPQDDLD RLAQQNQ                                157
//

If you have problems or comments...

PBIL Back to PBIL home page