(data stored in SCRATCH zone)

EMBL: CP000423.PE82

CP000423.PE82        Location/Qualifiers
FT   CDS             80339..80848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0084"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ68948"
FT                   /db_xref="GOA:Q03CX4"
FT                   /db_xref="UniProtKB/TrEMBL:Q03CX4"
FT                   /protein_id="ABJ68948.1"
FT                   /translation="MKKPMANAYVFNLIATVTSAVFSIFLITQNFPNVFQFGVSYKIDA
FT                   SNTALVKQLQMMYTPAIVVALIAAVLVFTLVITMLVLVKKRNVSALGSIIALGITLIQI
FT                   GYLSGLFWLVQSVQSAFSPAGDILQNPYIGPLLQLINLLLLGGSWIANLVVAIDYRRNG
FT                   IKEGRY"
     MKKPMANAYV FNLIATVTSA VFSIFLITQN FPNVFQFGVS YKIDASNTAL VKQLQMMYTP        60
     AIVVALIAAV LVFTLVITML VLVKKRNVSA LGSIIALGIT LIQIGYLSGL FWLVQSVQSA       120
     FSPAGDILQN PYIGPLLQLI NLLLLGGSWI ANLVVAIDYR RNGIKEGRY                   169
//

If you have problems or comments...

PBIL Back to PBIL home page