(data stored in SCRATCH zone)

EMBL: CP000423.PE84

CP000423.PE84        Location/Qualifiers
FT   CDS             81135..81641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0086"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ68950"
FT                   /db_xref="GOA:Q03CX2"
FT                   /db_xref="UniProtKB/TrEMBL:Q03CX2"
FT                   /protein_id="ABJ68950.1"
FT                   /translation="MDYIIYATFVVIFISMGTVVILYSSHIRAKAWAALSLDSKKNIAE
FT                   AAVTYAALTNIKRKAKMIKLCRYIAVATLLLSWAYFISNSTSNGIGSDELRNWILFLGN
FT                   TIFTIALIVEVSLNAYVTKVAKNTVPSVLSGKQAKMIWRLYVMSRIFFVIGCSAGSLLT
FT                   HSVFS"
     MDYIIYATFV VIFISMGTVV ILYSSHIRAK AWAALSLDSK KNIAEAAVTY AALTNIKRKA        60
     KMIKLCRYIA VATLLLSWAY FISNSTSNGI GSDELRNWIL FLGNTIFTIA LIVEVSLNAY       120
     VTKVAKNTVP SVLSGKQAKM IWRLYVMSRI FFVIGCSAGS LLTHSVFS                    168
//

If you have problems or comments...

PBIL Back to PBIL home page