(data stored in ACNUC7421 zone)

EMBL: CP000431.CHAA

CP000431.CHAA        Location/Qualifiers
FT   CDS             337391..338350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chaA"
FT                   /locus_tag="RHA1_ro00263"
FT                   /product="sodium calcium/ proton antiporter, CacA family
FT                   protein"
FT                   /note="bifunctional; tc: 2.A.19.1.1; GO_component:
FT                   GO:0016021 - integral to membrane"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00263"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92099"
FT                   /db_xref="GOA:Q0SK37"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK37"
FT                   /protein_id="ABG92099.1"
FT                   /translation="MLAAVHHAEVVAHKVGEPFGSLILAVAVTVIEVGLIVTLMISGGP
FT                   ATASLARDTVFAAVMLTVNGIMGLSLFVGARRYGVALFNAEGTGAALATVASLATLSLV
FT                   LPTFTTSRPGPEFSSAQLIFAAVASLVLYGMFVLTQTGPHRHFFLPVIPDEPVAVEDRN
FT                   AAPPSGRVAGMSLALLVLALCAVVGLAKVESPTIEDAVEDAGLPQSIVGVVIALLVLLP
FT                   ETLAAVRAAQRNRIQISLNLALGSAMASIGLTIPAIAVASIWLDGPLLLGLGPTQVVLL
FT                   AITVVVGMLTVVPGRATRLQGGVHLVLLAAYVFLSVNP"
     MLAAVHHAEV VAHKVGEPFG SLILAVAVTV IEVGLIVTLM ISGGPATASL ARDTVFAAVM        60
     LTVNGIMGLS LFVGARRYGV ALFNAEGTGA ALATVASLAT LSLVLPTFTT SRPGPEFSSA       120
     QLIFAAVASL VLYGMFVLTQ TGPHRHFFLP VIPDEPVAVE DRNAAPPSGR VAGMSLALLV       180
     LALCAVVGLA KVESPTIEDA VEDAGLPQSI VGVVIALLVL LPETLAAVRA AQRNRIQISL       240
     NLALGSAMAS IGLTIPAIAV ASIWLDGPLL LGLGPTQVVL LAITVVVGML TVVPGRATRL       300
     QGGVHLVLLA AYVFLSVNP                                                    319
//

If you have problems or comments...

PBIL Back to PBIL home page