(data stored in ACNUC7421 zone)

EMBL: CP000431.DPS

CP000431.DPS         Location/Qualifiers
FT   CDS             105754..106293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dps"
FT                   /locus_tag="RHA1_ro00101"
FT                   /product="DNA protection during starvation protein"
FT                   /note="GO_component: GO:0009289 - fimbrium; GO_function:
FT                   GO:0003677 - DNA binding; GO_function: GO:0008199 - ferric
FT                   iron binding; GO_process: GO:0006879 - iron ion
FT                   homeostasis; GO_process: GO:0006950 - response to stress"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00101"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91937"
FT                   /db_xref="GOA:Q0SKJ9"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR023188"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKJ9"
FT                   /protein_id="ABG91937.1"
FT                   /translation="MSKFTVPGLSDDQGARVADILQKRLSAYNDLHLTLKHIHWNVVGP
FT                   NFIGVHEMIDPQVELVRGYADAVAERIAALGNSPDGTPAAIARDRTWDDYSVKRDTAQA
FT                   HLGALDLVYSGVVGDNRKAIAETGDLDPITEDLLIGQTGELEKFQWFVRAHLENSGGSL
FT                   SNNGAHSEKQAAAQAR"
     MSKFTVPGLS DDQGARVADI LQKRLSAYND LHLTLKHIHW NVVGPNFIGV HEMIDPQVEL        60
     VRGYADAVAE RIAALGNSPD GTPAAIARDR TWDDYSVKRD TAQAHLGALD LVYSGVVGDN       120
     RKAIAETGDL DPITEDLLIG QTGELEKFQW FVRAHLENSG GSLSNNGAHS EKQAAAQAR        179
//

If you have problems or comments...

PBIL Back to PBIL home page