(data stored in ACNUC7421 zone)

EMBL: CP000431.PE1

CP000431.PE1         Location/Qualifiers
FT   CDS             complement(1391..2581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00001"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0003677 - DNA binding; GO_process:
FT                   GO:0000074 - regulation of progression through cell cycle"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00001"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91837"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKU9"
FT                   /protein_id="ABG91837.1"
FT                   /translation="MIWPEHRIETRPWNPRHRQGSRADRTLETVDVMIPPMIGALDCDL
FT                   VGVVARAHEEAVIAVARLEAGFGEHLAPLSDFLLRSESVASSKIEHIDAGWRAFGKALA
FT                   GGKSSAEAKSQLAAVKALIAMVDAAGDGPITGDTLLGAHRLLMAPDYYTARDSGRFRDV
FT                   QNWIGGSDYTPIDALFVPPPPELVDELLADLLEFANRTDLPILAQAAIAHAQLESIHPF
FT                   TDGNGRIGRALISAILRRRRLTHRVTVPLASVMLADTRRYFDHLTRYRAGDADGFVEYV
FT                   ARAAIVSSEAAQDSARALAELPSYWRDIARPRSNSADEKIIDALLGTPIFGADTAQQIT
FT                   GTTDASAYRALGRLTAAGVLEVLSESKRNQIWAATGVLAELDALSTTIGRRTTEHL"
     MIWPEHRIET RPWNPRHRQG SRADRTLETV DVMIPPMIGA LDCDLVGVVA RAHEEAVIAV        60
     ARLEAGFGEH LAPLSDFLLR SESVASSKIE HIDAGWRAFG KALAGGKSSA EAKSQLAAVK       120
     ALIAMVDAAG DGPITGDTLL GAHRLLMAPD YYTARDSGRF RDVQNWIGGS DYTPIDALFV       180
     PPPPELVDEL LADLLEFANR TDLPILAQAA IAHAQLESIH PFTDGNGRIG RALISAILRR       240
     RRLTHRVTVP LASVMLADTR RYFDHLTRYR AGDADGFVEY VARAAIVSSE AAQDSARALA       300
     ELPSYWRDIA RPRSNSADEK IIDALLGTPI FGADTAQQIT GTTDASAYRA LGRLTAAGVL       360
     EVLSESKRNQ IWAATGVLAE LDALSTTIGR RTTEHL                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page