(data stored in ACNUC7421 zone)

EMBL: CP000431.PE10

CP000431.PE10        Location/Qualifiers
FT   CDS             15608..16624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00010"
FT                   /product="probable transposase, mutator family protein"
FT                   /note="GO_function: GO:0004803 - transposase activity;
FT                   GO_process: GO:0006313 - DNA transposition"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00010"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91846"
FT                   /db_xref="GOA:Q0SKU0"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKU0"
FT                   /protein_id="ABG91846.1"
FT                   /translation="MLTEIGPVQIQVPRDTDASFDPQIVKKRQRRLTGVDEIILSLSAK
FT                   GLTTGEIAAHFDDVYGASVSKETISKITDKVLTEMAEWSVRPLDPVYPVLFIDAIHVKI
FT                   RDGQVANRPVYVAIGVTTAGEREILGLWAGDGGEGAKFWLAVLTEIRNRGVADVCIAVC
FT                   DGLKGLPDAITTVWPLTVVQTCLIHLLRNTFRYASRQYWDEMSRDLRPIYTAVNEAAAK
FT                   EQFTEFADKWGPRYPAIVRLWESAWSEFVPFLDYDPEIRRVICSTNAIESLNARYRRAV
FT                   RARGHFPSEQAALKCLYLATRSLDPSGKGRARWVTRWKPALNAFAITFEGRITPTVI"
     MLTEIGPVQI QVPRDTDASF DPQIVKKRQR RLTGVDEIIL SLSAKGLTTG EIAAHFDDVY        60
     GASVSKETIS KITDKVLTEM AEWSVRPLDP VYPVLFIDAI HVKIRDGQVA NRPVYVAIGV       120
     TTAGEREILG LWAGDGGEGA KFWLAVLTEI RNRGVADVCI AVCDGLKGLP DAITTVWPLT       180
     VVQTCLIHLL RNTFRYASRQ YWDEMSRDLR PIYTAVNEAA AKEQFTEFAD KWGPRYPAIV       240
     RLWESAWSEF VPFLDYDPEI RRVICSTNAI ESLNARYRRA VRARGHFPSE QAALKCLYLA       300
     TRSLDPSGKG RARWVTRWKP ALNAFAITFE GRITPTVI                               338
//

If you have problems or comments...

PBIL Back to PBIL home page