(data stored in ACNUC7421 zone)

EMBL: CP000431.PE100

CP000431.PE100       Location/Qualifiers
FT   CDS             complement(105031..105390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00100"
FT                   /product="cold shock protein"
FT                   /note="GO_function: GO:0003677 - DNA binding; GO_process:
FT                   GO:0006355 - regulation of transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00100"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91936"
FT                   /db_xref="GOA:Q0SKK0"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKK0"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91936.1"
FT                   /translation="MRTPRRSNAQRGSACGSARCESGGRRCAPRPGRSKGGTMSAGHTL
FT                   PARQSTALRTGTVRWFNAEQGFGFLAPADGSDDIFVHVSEIAGDGHRILEEGQRVSFAV
FT                   CRTETGDQARDVRIA"
     MRTPRRSNAQ RGSACGSARC ESGGRRCAPR PGRSKGGTMS AGHTLPARQS TALRTGTVRW        60
     FNAEQGFGFL APADGSDDIF VHVSEIAGDG HRILEEGQRV SFAVCRTETG DQARDVRIA        119
//

If you have problems or comments...

PBIL Back to PBIL home page